missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAPZA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | CAPZA3 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18168357
|
Novus Biologicals
NBP2-38425 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607315
|
Novus Biologicals
NBP2-38425-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CAPZA3 Polyclonal specifically detects CAPZA3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CAPZA3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CAPAA3, CAPPA3F-actin capping protein alpha-3 subunit, capping protein (actin filament) muscle Z-line, alpha 3, CapZ alpha-3, CP-alpha-3, F-actin-capping protein subunit alpha-3, Germ cell-specific protein 3, GSG3 | |
| CAPZA3 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96KX2 | |
| 93661 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title