missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carboxyl Ester Lipase/CEL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88502-25ul
This item is not returnable.
View return policy
Description
Carboxyl Ester Lipase/CEL Polyclonal specifically detects Carboxyl Ester Lipase/CEL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Carboxyl Ester Lipase/CEL | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 | |
| BAL, bile salt-activated lipase, Bile salt-stimulated lipase, BSDL, BSSLbile salt-dependent lipase, oncofetal isoform, bucelipase, carboxyl ester hydrolase, Carboxyl ester lipase, carboxyl ester lipase (bile salt-stimulated lipase), CEase, CELL, Cholesterol esterase, EC 3.1.1, EC 3.1.1.13, EC 3.1.1.3, FAP, FAPP, fetoacinar pancreatic protein, LIPA, lysophospholipase, pancreatic, MODY8bile-salt-activated lipase, Pancreatic lysophospholipase, Sterol esterase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1056 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CEL | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction