missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CARD8 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | CARD8 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228679
|
Novus Biologicals
NBP3-33499-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230057
|
Novus Biologicals
NBP3-33499-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CARD8 Monoclonal antibody specifically detects CARD8 in Human samples. It is validated for ELISA,Western BlotSpecifications
| CARD8 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 22900 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| Apoptotic protein NDPP1, CARD inhibitor of NF-kappaB-activating ligands, CARDINALFLJ18121, CARD-inhibitor of NF-kappa-B-activating ligand, caspase recruitment domain family, member 8, caspase recruitment domain-containing protein 8, DACAR, Dakar, KIAA0955DKFZp779L0366, NDPP, NDPP1MGC57162, TUCANFLJ18119, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine | |
| A synthetic peptide corresponding to a sequence within amino acids 110-209 of human CARD8 (NP_001171829.1).,, Sequence:, LSGGDIPSVSEEQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title