missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Casein Kinase 1 gamma 2 Polyclonal antibody specifically detects Casein Kinase 1 gamma 2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Casein Kinase 1 gamma 2 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | PE |
| Formulation | PBS |
| Gene Alias | casein kinase 1 isoform gamma-2, casein kinase 1, gamma 2, casein kinase I isoform gamma-2, CK1g2, CKI-gamma 2, EC 2.7.11, EC 2.7.11.1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 316-415 of human Casein Kinase 1 gamma 2 (NP_001310.3).,, Sequence:, FDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?