missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Caspase-12 Polyclonal antibody specifically detects Caspase-12 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Caspase-12 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | DyLight 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Apoptosis Related Cysteine Protease, CASP 12, casp12, CASP12P1, Caspase 12 pseudogene 1, Caspase12, UNQ9415 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2).,, Sequence:, FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?