missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBFA2T3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | CBFA2T3 |
|---|---|
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18274194
|
Novus Biologicals
NBP2-57636 |
100 μL |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693308
|
Novus Biologicals
NBP2-57636-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CBFA2T3 Polyclonal specifically detects CBFA2T3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CBFA2T3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 863 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| core-binding factor, runt domain, alpha subunit 2; translocated to, 3, hMTG16, MTG16ETO2, MTG8-related protein 2, MTGR2MTG8-related gene 2, Myeloid translocation gene on chromosome 16 protein, protein CBFA2T3, Zinc finger MYND domain-containing protein 4, ZMYND4myeloid translocation gene 8 and 16b | |
| CBFA2T3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title