missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBLB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86601
This item is not returnable.
View return policy
Description
CBLB Polyclonal antibody specifically detects CBLB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CBLB | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Cas-Br-M (murine) ecotropic retroviral transforming sequence b, Cas-Br-M (murine) ectropic retroviral transforming sequence b, Casitas B-lineage lymphoma proto-oncogene b, DKFZp686J10223, DKFZp779A0729, DKFZp779F1443, E3 ubiquitin-protein ligase CBL-B, EC 6.3.2, EC 6.3.2.-, FLJ41152, RING finger protein 56, RNF56FLJ36865, SH3-binding protein CBL-B, Signal transduction protein CBL-B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP | |
| 0.1 mL | |
| Signal Transduction | |
| 868 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction