missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-52871
This item is not returnable.
View return policy
Description
CBR1 Polyclonal antibody specifically detects CBR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CBR1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| 15-hydroxyprostaglandin dehydrogenase [NADP+], carbonyl reductase (NADPH) 1, carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase, carbonyl reductase [NADPH] 1, carbonyl reductase 1, CBR, CRN, EC 1.1.1.184, EC 1.1.1.189, hCBR1, NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductase, Prostaglandin-E(2) 9-reductase, SDR21C1, short chain dehydrogenase/reductase family 21C, member 1 | |
| Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected form the middle region of CBR1. Peptide sequence AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Stem Cell Markers | |
| 873 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin | |
| P16152 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction