missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC181 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 292.00 - € 549.00
Especificaciones
| Antigen | C1orf114 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
18462561
|
Novus Biologicals
NBP1-93901-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18046446
|
Novus Biologicals
NBP1-93901 |
0.1 mL |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
CCDC181 Polyclonal specifically detects CCDC181 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| C1orf114 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| chromosome 1 open reading frame 114, RP1-206D15.2 | |
| C1orf114 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 57821 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KSNHRTQSAHISPVTSTYCLSPRQKELQKQLEEKREKLKREEERRKIEEEKEKKRENDIVFKAWLQKKREQVLEMRRIQRAK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto