missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC68 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-47520-25ul
This item is not returnable.
View return policy
Description
CCDC68 Polyclonal specifically detects CCDC68 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CCDC68 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| coiled-coil domain containing 68, coiled-coil domain-containing protein 68, CTCL tumor antigen se57-1, CTCL-associated antigen se57-1, cutaneous T-cell lymphoma associated antigen, Cutaneous T-cell lymphoma-associated antigen se57-1, FLJ25368, SE57-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 80323 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CCDC68 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu