missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58012
This item is not returnable.
View return policy
Description
CCDC7 Polyclonal specifically detects CCDC7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| C10orf68 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| chromosome 10 open reading frame 68, dJ1104A8.1, FLJ13031, MGC149767, RP11-479G22.1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79741 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| C10orf68 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLKVFENQ | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu