missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCL27/CTACK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62684
This item is not returnable.
View return policy
Description
CCL27/CTACK Polyclonal antibody specifically detects CCL27/CTACK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CCL27/CTACK | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ALP, C-C motif chemokine 27, chemokine (C-C motif) ligand 27, CTACKSmall-inducible cytokine A27, CTAK, cutaneous T-cell attracting chemokine, Cutaneous T-cell-attracting chemokine, ESKINE, IL-11 Ralpha-locus chemokine, ILCCC chemokine ILC, PESKY, SCYA27IL-11 R-alpha-locus chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR | |
| 100 μg | |
| Biologically Active Proteins | |
| 10850 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction