missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCRL2/CRAM-A/B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 748.00
Specifications
| Antigen | CCRL2/CRAM-A/B |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18461072
|
Novus Biologicals
NBP1-85588-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18286667
|
Novus Biologicals
NBP1-85588 |
0.1 mL |
€ 748.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CCRL2/CRAM-A/B Polyclonal specifically detects CCRL2/CRAM-A/B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CCRL2/CRAM-A/B | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| C-C chemokine receptor-like 2, CCR11, CCR6, chemokine (C-C motif) receptor-like 2, Chemokine receptor CCR11, Chemokine receptor X, CKRXMGC116710, CRAM, CRAM-A, CRAM-B, FLJ55815, HCRMGC34104, Putative MCP-1 chemokine receptor | |
| CCRL2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9034 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title