missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18151679

Novus Biologicals™ CD27/TNFRSF7 Recombinant Protein Antigen

Produktkode 18151679 Shop alle Bio Techne produkter
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
Förpackningsstorlek
0.1mL
Denne vare kan ikke returneres. Se returpolitik

Produktkode 18151679

missing translation for 'mfr': Novus Biologicals™ NBP238434PEP

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD27. The CD27/TNFRSF7 Recombinant Protein Antigen is derived from E. coli. The CD27/TNFRSF7 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38434. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Tekniske data

Gene ID (Entrez) 939
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol CD27
Label Type Unlabeled
Molecular Weight (g/mol) 22kDa
Product Type CD27/TNFRSF7
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38434. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR
Vis mere Vis mindre

For Research Use Only

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.