missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD68/SR-D1 Antibody (CL1346), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-34482-25ul
This item is not returnable.
View return policy
Description
CD68/SR-D1 Monoclonal specifically detects CD68/SR-D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| CD68/SR-D1 | |
| Monoclonal | |
| Unconjugated | |
| P34810 | |
| CD68 | |
| This CD68/SR-D1 Antibody (CL1346) was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG | |
| 25 μL | |
| Cell Biology, Cytokine Research, Immunology, Microglia Markers | |
| 968 | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| CL1346 | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated | |
| CD68 antigenmacrophage antigen CD68, CD68 molecule, DKFZp686M18236, GP110, macrosialin, SCARD1, scavenger receptor class D, member 1 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Specificity of human CD68/SR-D1 Antibody (CL1346) verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction