missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD69 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 277.00 - € 549.00
Specifications
| Antigen | CD69 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18159577
|
Novus Biologicals
NBP2-37926 |
0.1 mL |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693026
|
Novus Biologicals
NBP2-37926-25ul |
25 μL |
€ 277.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD69 Polyclonal specifically detects CD69 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD69 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q07108 | |
| 969 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Activation inducer molecule, activation inducer molecule (AIM/CD69), AIM, BL-AC/P26, CD69 antigen, CD69 antigen (p60, early T-cell activation antigen), CD69 molecule, CLEC2CC-type lectin domain family 2 member C, C-type lectin domain family 2, member C, EA1, early activation antigen CD69, early lymphocyte activation antigen, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3 | |
| CD69 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title