missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD8 Antibody (CL1529), Novus Biologicals™
Mouse Monoclonal Antibody
€ 302.00 - € 430.00
Specifications
| Antigen | CD8 |
|---|---|
| Clone | CL1529 |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18608625
|
Novus Biologicals
NBP2-36743-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18173519
|
Novus Biologicals
NBP2-36743 |
0.1 mL |
€ 430.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD8 | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| P01732 | |
| 925 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT | |
| Primary | |
| Protein A purified |
| CL1529 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD8, CD8a molecule, LEU2, p32 | |
| CD8A | |
| IgG1 | |
| Protein A purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title