missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC25C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00
Specifications
| Antigen | CDC25C |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CDC25C Polyclonal specifically detects CDC25C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CDC25C | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Protein Phosphatase | |
| CDC 25, CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25 homolog C (S. pombe), cell division cycle 25C, Dual specificity phosphatase Cdc25C, EC 3.1.3.48, mitosis inducer CDC25, M-phase inducer phosphatase 3, phosphotyrosine phosphatase | |
| CDC25C | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 995 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title