missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC25C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00
Specifications
| Antigen | CDC25C |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CDC25C Polyclonal specifically detects CDC25C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CDC25C | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Protein Phosphatase | |
| CDC 25, CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25 homolog C (S. pombe), cell division cycle 25C, Dual specificity phosphatase Cdc25C, EC 3.1.3.48, mitosis inducer CDC25, M-phase inducer phosphatase 3, phosphotyrosine phosphatase | |
| CDC25C | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 995 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto