missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC42BPG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84072-25ul
This item is not returnable.
View return policy
Description
CDC42BPG Polyclonal specifically detects CDC42BPG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CDC42BPG | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CDC42 binding protein kinase gamma (DMPK-like), CDC42-binding protein kinase gamma, DMPK2MRCK gamma, DMPK-like gamma, EC 2.7.11, EC 2.7.11.1, HSMDPKIN, kappa-200, MRCKgamma, Myotonic dystrophy kinase-related CDC42-binding kinase gamma, myotonic dystrophy protein kinase like protein, Myotonic dystrophy protein kinase-like alpha, Myotonic dystrophy protein kinase-like gamma, serine/threonine-protein kinase MRCK gamma | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CDC42BPG | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH | |
| 25 μL | |
| Protein Kinase | |
| 55561 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction