missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC42SE2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82131-25ul
This item is not returnable.
View return policy
Description
CDC42SE2 Polyclonal specifically detects CDC42SE2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CDC42SE2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CDC42 small effector 2, FLJ21967, non-kinase Cdc42 effector protein SPEC2, Small effector of CDC42 protein 2, SPEC2CDC42 small effector protein 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CDC42SE2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG | |
| 25 μL | |
| Protein Kinase | |
| 56990 | |
| Human, Mouse, Rat | |
| IgG |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?
For Research Use Only