missing translation for 'onlineSavingsMsg'
Learn More

CDK20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-91213

View more versions of this product

Product Code. 18423742

€ 572.00 / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

CDK20 Polyclonal antibody specifically detects CDK20 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	CDK20
Classification	Polyclonal
Dilution	Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	CAK-kinase p42, CCRKEC 2.7.11.22, CDCHP42, CDK-activating kinase p42, cell cycle related kinase, Cell cycle-related kinase, Cell division protein kinase 20, cyclin-dependent kinase 20, Cyclin-dependent protein kinase H, Cyclin-kinase-activating kinase p42, EC 2.7.11, p42, PNQALRE
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHG
Quantity	0.1 mL
Research Discipline	Protein Kinase
Gene ID (Entrez)	23552
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

CDK20 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions