missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEBP Beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | CEBP Beta |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228980
|
Novus Biologicals
NBP3-35083-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231322
|
Novus Biologicals
NBP3-35083-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEBP Beta Polyclonal antibody specifically detects CEBP Beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
| CEBP Beta | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Phospho Specific | |
| PBS (pH 7.3), 50% glycerol | |
| 1051 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| C/EBP beta, C/EBP-beta, CCAAT/enhancer binding protein (C/EBP), beta, CCAAT/enhancer-binding protein beta, CRP2, IL6DBP, interleukin 6-dependent DNA-binding protein, LAPTCF-5, Liver activator protein, liver-enriched transcriptional activator protein, MGC32080, NF-IL6, Nuclear factor NF-IL6, nuclear factor of interleukin 6, TCF5NFIL6, Transcription factor 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human CEBP Beta (NP_005185.2).,, Sequence:, AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title