missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEECAM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | CEECAM1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18241252
|
Novus Biologicals
NBP2-58669 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18645418
|
Novus Biologicals
NBP2-58669-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEECAM1 Polyclonal specifically detects CEECAM1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CEECAM1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 51148 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| CEECAM1, CerCAM, cerebral endothelial cell adhesion molecule 1, cerebral endothelial cell adhesion moleculeMGC149621, GLT25D3cerebral cell adhesion molecule, glycosyltransferase 25 domain containing 3, glycosyltransferase 25 family member 3, KIAA1502, MGC149620 | |
| CERCAM | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title