missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEP164 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | CEP164 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18692547
|
Novus Biologicals
NBP2-68776-25ul |
25 μL |
 € 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18640289
|
Novus Biologicals
NBP2-68776 |
100 μg |
€ 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEP164 Polyclonal antibody specifically detects CEP164 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| CEP164 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication, Direct Reversal of DNA Damage | |
| PBS (pH 7.2) and 40% Glycerol | |
| 22897 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| centrosomal protein 164kDa, FLJ54767 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title