missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHAF1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 415.00 - € 539.00
Specifications
| Antigen | CHAF1B |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Chromatin Immunoprecipitation (ChIP) |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18452031
|
Novus Biologicals
NBP1-88235-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18237916
|
Novus Biologicals
NBP1-88235 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CHAF1B Polyclonal specifically detects CHAF1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP).Specifications
| CHAF1B | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13112 | |
| 8208 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 61 kDa |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Chromatin Immunoprecipitation (ChIP) | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Cycle and Replication, Chromatin Research | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CAF1, CAF-1, CAF1ACAF-1 subunit B, CAF1P60CAF-I 60 kDa subunit, CAF-IP60, chromatin assembly factor 1 subunit B, chromatin assembly factor 1, subunit B (p60), Chromatin assembly factor I p60 subunit, human chromatin assembly factor-I p60 subunit, 10, MPHOSPH7CAF-I p60, MPP7M-phase phosphoprotein 7 | |
| CHAF1B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title