missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHD2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92117-0.1ml
This item is not returnable.
View return policy
Description
CHD2 Polyclonal antibody specifically detects CHD2 in Human samples. It is validated for Western Blot
Specifications
| CHD2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| ATP-dependent helicase CHD2, CHD-2, chromodomain helicase DNA binding protein 2, chromodomain-helicase-DNA-binding protein 2, DKFZp547I1315, DKFZp686E01200, DKFZp781D1727, EC 3.6.1, EC 3.6.4.12, FLJ38614 | |
| A synthetic peptide corresponding to a sequence within amino acids 1729-1828 of human CHD2 (NP_001262.3). DEFRPQNYHQQDFRRMSDHRPAMGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSKSPLDHRSPLERSLEQKNNPDYNWNVRKT | |
| 0.1 mL | |
| Chromatin Research | |
| 1106 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction