missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CHD3 Polyclonal antibody specifically detects CHD3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | CHD3 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | PE |
| Formulation | PBS |
| Gene Alias | ATP-dependent helicase CHD3, CHD-3, chromodomain helicase DNA binding protein 3, chromodomain-helicase-DNA-binding protein 3, EC 3.6.1, EC 3.6.4.12, hZFH, Mi-2 autoantigen 240 kDa protein, Mi-2a, Mi2-ALPHA, ZFH, Zinc finger helicase, zinc-finger helicase (Snf2-like) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human CHD3 (NP_001005273.1).,, Sequence:, ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?