missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHERP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Especificaciones
| Antigen | CHERP |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
30227603
|
Novus Biologicals
NBP3-38614-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230111
|
Novus Biologicals
NBP3-38614-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
CHERP Polyclonal antibody specifically detects CHERP in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotEspecificaciones
| CHERP | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| calcium homeostasis endoplasmic reticulum protein, DAN16, DAN26, ERPROT 213-21, ERPROT213-21, protein with polyglutamine repeat, SCAF6, SRA1, SR-related CTD associated factor 6, SR-related CTD-associated factor 6 | |
| A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3).,, Sequence:, LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 10523 | |
| IgG | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto