missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHIC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 540.75
Specifications
| Antigen | CHIC2 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18661078
|
Novus Biologicals
NBP2-68599-25ul |
25 μL |
 € 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18640659
|
Novus Biologicals
NBP2-68599 |
100 μg |
€ 572.00 € 540.75 / 100µL Save € 31.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CHIC2 Polyclonal antibody specifically detects CHIC2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| CHIC2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| BTLBrX-like translocated in leukemia, cysteine-rich hydrophobic domain 2, cysteine-rich hydrophobic domain 2 protein, cystein-rich hydrophobic domain 2, MGC21173 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 26511 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title