missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHMP4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49018-25ul
This item is not returnable.
View return policy
Description
CHMP4B Polyclonal antibody specifically detects CHMP4B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CHMP4B | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C20orf178, charged multivesicular body protein 4b, CHMP4A, CHMP4b, chromatin modifying protein 4B, Chromatin-modifying protein 4b, chromosome 20 open reading frame 178, dJ553F4.4, hSnf7-2, hVps32-2, SHAX1, SNF7, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, SNF7-2CTPP3, Vacuolar protein sorting-associated protein 32-2, vacuolar protein-sorting-associated protein 32-2, Vps32-2, VPS32B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSV | |
| 25 μL | |
| Autophagy, Cell Biology, Cell Cycle and Replication, Immunology, Signal Transduction | |
| 128866 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction