missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHST14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | CHST14 |
|---|---|
| Dilution | Western Blot 1:250 - 1:500, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18202313
|
Novus Biologicals
NBP2-57389 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18609476
|
Novus Biologicals
NBP2-57389-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CHST14 Polyclonal specifically detects CHST14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CHST14 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 113189 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:250 - 1:500, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Unconjugated | |
| RUO | |
| Human | |
| ATCS, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14, D4ST-1, D4ST1carbohydrate sulfotransferase 14, dermatan 4 sulfotransferase 1, Dermatan 4-sulfotransferase 1, EC 2.8.2.-, HD4ST, hD4ST1, HNK1ST | |
| CHST14 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title