missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CISD1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92696-0.1ml
This item is not returnable.
View return policy
Description
CISD1 Polyclonal antibody specifically detects CISD1 in Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| CISD1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| C10orf70, CDGSH iron sulfur domain 1, CDGSH iron sulfur domain-containing protein 1, CDGSH iron-sulfur domain-containing protein 1, chromosome 10 open reading frame 70, MDS029, MGC14684, mitoNEET, ZCD1, zinc finger CDGSH-type domain 1, zinc finger, CDGSH-type domain 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1). LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 55847 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction