missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-87450
This item is not returnable.
View return policy
Description
Claudin-12 Polyclonal specifically detects Claudin-12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Claudin-12 | |
| Polyclonal | |
| CLDN12 | |
| Affinity Purified | |
| IgG |
| Western Blot | |
| claudin 12, claudin-12 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT | |
| 0.1 mL |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction