missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 222.00 - € 487.00
Specifications
| Antigen | Claudin-2 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18647251
|
Novus Biologicals
NBP2-92140-0.02ml |
0.02 mL |
€ 222.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665371
|
Novus Biologicals
NBP2-92140-0.1ml |
0.1 mL |
€ 487.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Claudin-2 Polyclonal antibody specifically detects Claudin-2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Claudin-2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Extracellular Matrix | |
| PBS with 50% glycerol, pH7.3. | |
| 9075 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| claudin 2, claudin-2, SP82 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 184-230 of human Claudin-2 (NP_001164563.1). SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title