missing translation for 'onlineSavingsMsg'
Learn More
Learn More
cleavage stimulation factor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57707-25ul
This item is not returnable.
View return policy
Description
cleavage stimulation factor Polyclonal specifically detects cleavage stimulation factor in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| cleavage stimulation factor | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CF-1 50 kDa subunit, Cleavage stimulation factor 50 kDa subunit, cleavage stimulation factor subunit 1, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa, CSTF 50 kDa subunit, CstF-50, CstFp50 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| CSTF1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS | |
| 25 μL | |
| DNA replication Transcription Translation and Splicing | |
| 1477 | |
| Human | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering