missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLEC3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | CLEC3A |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunofluorescence |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18427661
|
Novus Biologicals
NBP2-30595-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18198393
|
Novus Biologicals
NBP2-30595 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CLEC3A Polyclonal specifically detects CLEC3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CLEC3A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cartilage-derived C-type lectin, CLECSF1, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived), C-type lectin domain family 3 member A, C-type lectin domain family 3, member A, C-type lectin superfamily member 1, C-type lectin, superfamily member 1, MGC129558, MGC129559 | |
| CLEC3A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunofluorescence | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O75596 | |
| 10143 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title