missing translation for 'onlineSavingsMsg'
Learn More

CLIC4 Antibody, Novus Biologicals™

Product Code. p-200104049 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30229645 100 μL 100µL
30228236 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30229645 Supplier Novus Biologicals Supplier No. NBP333286100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

CLIC4 Monoclonal antibody specifically detects CLIC4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CLIC4
Applications ELISA, Western Blot
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias chloride intracellular channel 4, chloride intracellular channel 4 like, chloride intracellular channel protein 4, CLIC4L, DKFZp566G223, FLJ38640, H1, huH1, Intracellular chloride ion channel protein p64H1, MTCLIC, p64H1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CLIC4 (NP_039234.1).,, Sequence:, MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 25932
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.