missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMTM4 Antibody (6G4), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00146223-M01
This item is not returnable.
View return policy
Description
CMTM4 Monoclonal antibody specifically detects CMTM4 in Human samples. It is validated for Western Blot, ELISA
Specifications
| CMTM4 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| chemokine-like factor super family 4, chemokine-like factor superfamily 4, Chemokine-like factor superfamily member 4, CKLF-like MARVEL transmembrane domain containing 4, CKLF-like MARVEL transmembrane domain-containing protein 4, CKLFSF4 | |
| CKLFSF4 (NP_848933, 173 a.a. ∽ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA | |
| 0.1 mg | |
| Cytokine Research | |
| 146223 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA | |
| 6G4 | |
| Western Blot 1:500, ELISA | |
| NP_848933 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction