missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COL11A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 369.00 - € 574.00
Specifications
| Antigen | COL11A1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18065564
|
Novus Biologicals
NBP2-58159 |
100 μL |
€ 574.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624347
|
Novus Biologicals
NBP2-58159-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
COL11A1 Polyclonal specifically detects COL11A1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
| COL11A1 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| 1301 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| alpha-1 polypeptide, COLL6, collagen, type XI, alpha 1 | |
| COL11A1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title