missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen I alpha 1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 237.00 - € 493.00
Specifications
| Antigen | Collagen I alpha 1 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:2000 - 1:10000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18617282
|
Novus Biologicals
NBP2-92877-0.02ml |
0.02 mL |
€ 237.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686902
|
Novus Biologicals
NBP2-92877-0.1ml |
0.1 mL |
€ 493.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Collagen I alpha 1 Polyclonal antibody specifically detects Collagen I alpha 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Collagen I alpha 1 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Stem Cells | |
| PBS with 50% glycerol, pH7.3. | |
| 1277 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:2000 - 1:10000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Alpha-1 type I collagen, COL-IA1, Collagen 1, Collagen 1 alpha 1, collagen alpha 1 chain type I, collagen alpha-1(I) chain, collagen of skin, tendon and bone, alpha-1 chain, Collagen Type I Alpha 1 Chain, collagen, type I, alpha 1, Collagen1, Collagen-1, EDSARTH1, OI4, pro-alpha-1 collagen type 1, Type I Procollagen Alpha 1 Chain | |
| A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human Collagen I alpha 1 (NP_000079.2). GEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title