missing translation for 'onlineSavingsMsg'
Learn More

Collagen III alpha 1/COL3A1 Antibody, Novus Biologicals™

Product Code. 18291787 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18291787 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18291787 Supplier Novus Biologicals Supplier No. NBP184007

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Collagen III alpha 1/COL3A1 Polyclonal specifically detects Collagen III alpha 1/COL3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Collagen III alpha 1/COL3A1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P02461
Gene Alias alpha1 (III) collagen, Collagen 3, collagen alpha-1(III) chain, collagen, fetal, collagen, type III, alpha 1, Collagen-3, EDS4A, Ehlers-Danlos syndrome type IV, autosomal dominant, FLJ34534
Gene Symbols COL3A1
Host Species Rabbit
Immunogen This Collagen III alpha 1/COL3A1 Antibody was developed against a recombinant protein corresponding to amino acids: RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Molecular Weight of Antigen 139 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 1281
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.