missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen V Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35507-100ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Collagen V Polyclonal antibody specifically detects Collagen V in Human,Mouse samples. It is validated for ELISA,Western Blot
Spezifikation
| Collagen V | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| alpha 1 type V collagen, Collagen 5, collagen alpha-1(V) chain, collagen, type V, alpha 1, Collagen-5, EC 2.7.7.6, EC 6.1.1 | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Collagen V (NP_000084.3).,, Sequence:, LPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY | |
| 100 μL | |
| Cell Biology, Cellular Markers, Extracellular Matrix | |
| 1289 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur