missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
Collagen VI alpha 2 Polyclonal specifically detects Collagen VI alpha 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
Specifica
| Antigen | Collagen VI alpha 2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | collagen alpha-2(VI) chain, collagen VI, alpha-2 polypeptide, collagen, type VI, alpha 2,10PP3610, DKFZp586E1322, FLJ46862 |
| Gene Symbols | COL6A2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?