missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement Component C5aR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21274-25ul
This item is not returnable.
View return policy
Description
Complement Component C5aR1 Polyclonal antibody specifically detects Complement Component C5aR1 in Human samples. It is validated for Western Blot
Specifications
| Complement Component C5aR1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml | |
| C5A, C5a anaphylatoxin chemotactic receptor, C5aR, C5a-R, C5ARC5a anaphylatoxin receptor, C5R1C5a ligand, CD88, CD88 antigen, complement component 5 receptor 1, complement component 5 receptor 1 (C5a ligand), complement component 5a receptor 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI | |
| 25 μg | |
| GPCR, Immunology, Innate Immunity | |
| 728 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction