missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18075464

R&D Systems™ Complement Factor B Recombinant Protein Antigen

Code produit 18075464 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantity:
0.1 mL
Conditionnement:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity Conditionnement
18075464 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18075464 Fournisseur R&D Systems™ Code fournisseur NBP189985PEP
 Restricted Item
Estimated Shipment: 15-01-2027
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CFB. The Complement Factor B Recombinant Protein Antigen is derived from E. coli. The Complement Factor B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89985. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 629
Species Human
Product Line Novus
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias BF AHUS4, B-factor, properdin, BFD, C3 proaccelerator, C3 proactivator, C3/C5 convertase, complement factor B, EC 3.4.21, EC 3.4.21.47, FB, FBI12, GBGCFAB, Glycine-rich beta glycoprotein, glycine-rich beta-glycoprotein, H2-Bf, PBF2, Properdin factor B
Gene Symbol CFB
Label Type Unlabeled
Molecular Weight (g/mol) 34kDa
Product Type Complement Factor B
Quantity 0.1 mL
Regulatory Status RUO
Research Category Immunology
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89985. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.