missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Connexin 36/GJD2 Polyclonal antibody specifically detects Connexin 36/GJD2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | Connexin 36/GJD2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:200-1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | Connexin-36, Cx36, CX36connexin 36, Gap junction alpha-9 protein, gap junction delta-2 protein, gap junction protein, alpha 9, 36kDa, gap junction protein, delta 2, 36kDa, GJA9connexin-36, MGC138315, MGC138319 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1). HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?