missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Contactin-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Tekniske data
| Antigen | Contactin-1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18654887
|
Novus Biologicals
NBP2-68900-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631819
|
Novus Biologicals
NBP2-68900 |
100 μg |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
Contactin-1 Polyclonal antibody specifically detects Contactin-1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Tekniske data
| Contactin-1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| contactin 1, contactin-1, F3, Glycoprotein gp135, GP135, Neural cell surface protein F3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1272 | |
| IgG | |
| Protein A purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel