missing translation for 'onlineSavingsMsg'
Learn More

COQ6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-13860

View more versions of this product

Product Code. 18034659

€ 624.00
€ 590.10 / 0.10mL
Save € 33.90
5% Off

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

COQ6 Polyclonal specifically detects COQ6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	COQ6
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	CGI-10, coenzyme Q6 homolog (yeast), coenzyme Q6 homolog, monooxygenase (S. cerevisiae), coenzyme Q6 homolog, monooxygenase (yeast), EC 1.14.13, EC 1.14.13.-, ubiquinone biosynthesis monooxygenase COQ6
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	51004
Target Species	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	COQ6
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLE
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Cancel Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

COQ6 Antibody, Novus Biologicals™

Description

Specifications

Produktförslag

Dokument

Kampanjer