missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cornulin Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92568-0.02ml
This item is not returnable.
View return policy
Description
Cornulin Polyclonal antibody specifically detects Cornulin in Human, Mouse samples. It is validated for Western Blot
Specifications
| Cornulin | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| 53 kDa squamous epithelial-induced stress protein, 58 kDa heat shock protein, chromosome 1 open reading frame 10, cornulin, DRC1, PDRC1,53 kDa putative calcium-binding protein, SEP53C1orf10, Squamous epithelial heat shock protein 53, Tumor-related protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1). GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP | |
| 0.02 mL | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 49860 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction