missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
COX7A2L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifikationer
| Antigen | COX7A2L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18226705
|
Novus Biologicals
NBP2-56202 |
100 μL |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663398
|
Novus Biologicals
NBP2-56202-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
COX7A2L Polyclonal specifically detects COX7A2L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| COX7A2L | |
| Polyclonal | |
| Rabbit | |
| Human | |
| COX7ARcytochrome c oxidase subunit VII-related protein, COX7a-related protein, COX7RPmitochondrial, cytochrome c oxidase subunit VIIa polypeptide 2 like, Cytochrome c oxidase subunit VIIa-related protein, estrogen receptor binding CpG island, SIG81 | |
| COX7A2L | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9167 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel